Basic Information | |
---|---|
Taxon OID | 3300005512 Open in IMG/M |
Scaffold ID | Ga0074648_1053873 Open in IMG/M |
Source Dataset Name | Saline surface water microbial communities from Etoliko Lagoon, Greece - halocline_water |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1713 |
Total Scaffold Genes | 5 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (60.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Epilimnion → Saline Water And Sediment → Saline Water And Sediment Microbial Community From Etoliko Lagoon, Greece |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Greece: Etoliko Lagoon | |||||||
Coordinates | Lat. (o) | 38.4825 | Long. (o) | 21.315 | Alt. (m) | Depth (m) | 0 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F042075 | Metagenome | 159 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0074648_10538735 | F042075 | AGGAG | MSIHQFTTSEPNPPFAEMRMSSYNDYCFDCDCEAISPIDWGTWKRLVGELLADGAGDAWACMY |
⦗Top⦘ |