NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0074648_1063633

Scaffold Ga0074648_1063633


Overview

Basic Information
Taxon OID3300005512 Open in IMG/M
Scaffold IDGa0074648_1063633 Open in IMG/M
Source Dataset NameSaline surface water microbial communities from Etoliko Lagoon, Greece - halocline_water
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)1496
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (83.33%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Epilimnion → Saline Water And Sediment → Saline Water And Sediment Microbial Community From Etoliko Lagoon, Greece

Source Dataset Sampling Location
Location NameGreece: Etoliko Lagoon
CoordinatesLat. (o)38.4825Long. (o)21.315Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F012534Metagenome / Metatranscriptome280N
F034001Metagenome / Metatranscriptome176Y
F100031Metagenome / Metatranscriptome103N

Sequences

Protein IDFamilyRBSSequence
Ga0074648_10636332F100031AGGMITQKMYNDYLESMKDEDWKSIRAKIEERYPETITWPEKMFRMYCSAVVRSGFRKEGLN*
Ga0074648_10636333F012534AGGAMDQKDKDIRWAASQFLYEDLPDDYQNWPDIKLFKFLKHYAWKPFEHYSGQWLWCHIQDLAVQVRKYAEEN*
Ga0074648_10636334F034001GAGMRKRIKHNDLLPWFTDDHRDLPPAYLKSCQKFFDSLKQQAPSSKPQASSNKQVTSVPEYDITKTEREKK*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.