NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0070374_10077854

Scaffold Ga0070374_10077854


Overview

Basic Information
Taxon OID3300005517 Open in IMG/M
Scaffold IDGa0070374_10077854 Open in IMG/M
Source Dataset NameFreshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1728
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (66.67%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Associated Families4

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Freshwater Lake Microbial Communities From The Great Lakes, Usa, Analyzing Microbial Food Webs And Carbon Cycling

Source Dataset Sampling Location
Location NameLake Michigan, USA
CoordinatesLat. (o)43.1998Long. (o)-86.5698Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000311Metagenome / Metatranscriptome1326Y
F000714Metagenome / Metatranscriptome924Y
F001043Metagenome / Metatranscriptome794Y
F001125Metagenome / Metatranscriptome769Y

Sequences

Protein IDFamilyRBSSequence
Ga0070374_100778541F000714N/ATKEETMEETTTTAVTVPDTYNPNLLVTYKVIRGYSDAEYATDKVASLEWDLHNGRQSQKNVTTLQSKIATAKDIIAEAYADSSDQDTLRSIAEALGIELTRTVEFTCSIEVSGTIELDLLEDYDIEDEITDNLYVDSQSGRIEIGDIEVCHVREC*
Ga0070374_100778542F000311GGAGMYFELTAPNQVAFARATWDAELMGLDPMTIAPLTFNIGTGSIEKVSRIRDKYNLIESYTSDYEPTGYTGR*
Ga0070374_100778543F001043GGAGMSDYKDGFDDGYKFAREELMEKLAEIDIMDIDAWILDRISEMIEGGTL*
Ga0070374_100778545F001125GGCGGMGDRANFGFKQSDGNTIFLYGHWAGYNMLANLASAVLAAQPRWNDESYATRIAISNLIGDDWAQETGWGLSVGRLLDNEHKVPVINWTAKTFTLFEEDLTTEVFSLSLGDFVEKYSRLVMV*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.