Scaffold Ga0077119_10004875

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0077119_10004875

Scaffold Ga0077119_10004875

Overview

Basic Information
Taxon OID	3300005519 Open in IMG/M
Scaffold ID	Ga0077119_10004875 Open in IMG/M
Source Dataset Name	Combined assembly of arab plate scrape CL_Col (Combined Assembly)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	15636
Total Scaffold Genes	19 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	13 (68.42%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Roots → Epiphytes → Unclassified → Arabidopsis Root → Arabidopsis, Maize, Boechera And Miscanthus Rhizosphere Microbial Communities From Different Us Locations

Source Dataset Sampling Location
Location Name	University of North Carolina, USA
Coordinates	Lat. (^o)	35.9082	Long. (^o)	-79.0499	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F090602	Metagenome / Metatranscriptome	108	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0077119_100048758	F090602	GAG	MNQHLHTAPAARVEWELLPSLLNRLGSRRPRSQPAWMDTMPSEIGFLEPSDPFEEVLPGLEMREVREPDIFDIFFG*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.