Scaffold Ga0068877_10267833

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0068877_10267833

Scaffold Ga0068877_10267833

Overview

Basic Information
Taxon OID	3300005525 Open in IMG/M
Scaffold ID	Ga0068877_10267833 Open in IMG/M
Source Dataset Name	Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaG
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	998
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → Campylobacterales → Campylobacteraceae → Campylobacter → Campylobacter coli	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Freshwater Lake Microbial Communities From Lake Erie, Under A Cyanobacterial Bloom.

Source Dataset Sampling Location
Location Name	USA: Ohio, Lake Erie
Coordinates	Lat. (^o)	41.69957	Long. (^o)	-83.2941	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F031456	Metagenome / Metatranscriptome	182	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0068877_102678331	F031456	N/A	MALIGQFPASGSAVFNLDFLPEYVLVNSAGAATQALTNFSVVTSGTQLMSITDVNRLTALAKFDSGAILDDPNAPGTVNSTTASYIRLASGRINKATTITGTNGIAAIQNFYAASTNITNVARRAVEQSINPSANATFDNFEALFFSGANILRAQITYANGFTDEFTVPELQGLYSKFHVADAFGNLESLLCIDADSGAGLISQVVLFAGAGAAVVVLKTDYVQL*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.