NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0070734_10000555

Scaffold Ga0070734_10000555


Overview

Basic Information
Taxon OID3300005533 Open in IMG/M
Scaffold IDGa0070734_10000555 Open in IMG/M
Source Dataset NameSurface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)73618
Total Scaffold Genes70 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)55 (78.57%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil → Surface Soil Microbial Communities From Centralia Pennsylvania, Which Are Recovering From An Underground Coalmine Fire.

Source Dataset Sampling Location
Location NameUSA: Pennsylvania, Centralia
CoordinatesLat. (o)40.7999Long. (o)-76.3402Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F074640Metagenome119Y
F080540Metagenome / Metatranscriptome115N

Sequences

Protein IDFamilyRBSSequence
Ga0070734_1000055530F080540GGAGGLADATEERLQFAWKNFEDQQAIIRAADLKAGYLVTFLLFFGASTIPLGREVFPKLRLDAVRGPASLIYAVSYVLSVIGFVWSMYLISHVMTPRAKKHSSEPKPGADLLFFGHITKFESSDKYFEAVSRVEPEQILRNVTDQIFELAQIAKAKLDSLKAFSRSFKLTLVAWFISTAVGFWIMSWK*
Ga0070734_1000055554F074640GGAGVVANGKLGLRIGLGLAAILAIFVGAPASKAQTAGIAGKYQCTQVKVHGKVKSCSSSQLNLKADGHFELRGWEGDYSIAGSYVELSDKSVKSKAKLEPGYKLIFKYQGKDGVVEVTYERRQSAPANEALS*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.