NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0070672_100256821

Scaffold Ga0070672_100256821


Overview

Basic Information
Taxon OID3300005543 Open in IMG/M
Scaffold IDGa0070672_100256821 Open in IMG/M
Source Dataset NameMiscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1473
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere → Corn, Switchgrass And Miscanthus Rhizosphere Microbial Communities From Kellogg Biological Station, Michigan, Usa

Source Dataset Sampling Location
Location NameUSA: Michigan, Kellogg Biological Station
CoordinatesLat. (o)42.3948Long. (o)-85.3738Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F021411Metagenome / Metatranscriptome219Y
F051558Metagenome / Metatranscriptome144N

Sequences

Protein IDFamilyRBSSequence
Ga0070672_1002568211F021411AGGMTTSPIEVREEIDVVSVDPLFIERQRNRYSSRAVAYVVWLNGLAAIALLIGLTHASLRADQVKGFADAMLVFGAGSVCGLASAFFAYIGRTFRLERPHLIGWRRPIRWLAILAAIAGAVCFIG
Ga0070672_1002568213F051558AGGMPKKADIKASLRGIASALHNFMGTGSEERLPEKLVTLSERLTKSSHQDDPRIEPAIGEVQMSQKLAKSAAELESMIMAELREHPECDSAAVEVTSKEIGWDAVLVRAGTQLNDPCEAMLVEITERLRREFDLSE*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.