NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0070696_100259806

Scaffold Ga0070696_100259806


Overview

Basic Information
Taxon OID3300005546 Open in IMG/M
Scaffold IDGa0070696_100259806 Open in IMG/M
Source Dataset NameCorn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1316
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere → Corn, Switchgrass And Miscanthus Rhizosphere Microbial Communities From Kellogg Biological Station, Michigan, Usa

Source Dataset Sampling Location
Location NameUSA: Michigan: Kellogg Biological Station
CoordinatesLat. (o)42.3948Long. (o)-85.3738Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F006214Metagenome / Metatranscriptome378Y
F064573Metagenome128Y

Sequences

Protein IDFamilyRBSSequence
Ga0070696_1002598061F006214AGGAGGMALPLLLVLLQAARPATAPAQTPVGSVAAWTLHFNGDIRWQQITPAGALLVSSDAALAGVDVEHGQIVWQKPDLGGLPVDSVRMVEGSLLMEAAKPGLSVIFDPVTGTVLFDSRALGLTRVVTRRVLPQTGTLIVHGRRASGPPVVALYDLKTGNQRWVSESLFQQTGPKKGGLGGLMQG
Ga0070696_1002598062F064573N/AELPPVTVTAPRCTRPGRPDSSDAALLAVFDQLLENARRFELLANSYPFEYDLEIATREVSARGDTSDPQLRRLRLSSKENHPYAVGRVVEPAWGPWGNPDSFVVIHSAELQDLGNPAFVASHCFQLVGRDTIGGDTLVRIDFDPAIRIGSADMAGAAYLDPMTYELRYTETSLTRPERSRLADVRAMRFRTRFRNIARGVPLQDSLTVLTTYRYGRRAKIDTQRTVEIRFRREPPPR*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.