NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0070665_100087265

Scaffold Ga0070665_100087265


Overview

Basic Information
Taxon OID3300005548 Open in IMG/M
Scaffold IDGa0070665_100087265 Open in IMG/M
Source Dataset NameSwitchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3125
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (20.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere → Corn, Switchgrass And Miscanthus Rhizosphere Microbial Communities From Kellogg Biological Station, Michigan, Usa

Source Dataset Sampling Location
Location NameUSA: Michigan, Kellogg Biological Station
CoordinatesLat. (o)42.3948Long. (o)-85.3738Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001830Metagenome / Metatranscriptome629Y
F007233Metagenome / Metatranscriptome355Y

Sequences

Protein IDFamilyRBSSequence
Ga0070665_1000872651F007233GGAGMANRKQRRYERKVNVDRFRKGIKGKVLDAISISNELDCRYLSLEFEDKTELTITLDTRLTGKLELFDWKTGDQRLIRKV
Ga0070665_1000872652F001830N/AMTSQHTVQVREKAVRLCQRVLQYSSGVPFKARIILGLFLVAAVFMAIHTAITAKDASLHLKLQHEFRTAQVSVWVDNDLAYAGTITGSTKKKFGLIPSDSVQGNLSQIIPVRSGQHDIRLRIEPDDAAMQEDAIRGEFSDYTECDLAVSARHSGLSLSWQGTRSTSVESSSTVGWLSGYVGSFILTITGSIVSALAGYAIKELPMRLRSTSNSAPKTDL*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.