Scaffold Ga0066700_10000458

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0066700_10000458

Scaffold Ga0066700_10000458

Overview

Basic Information
Taxon OID	3300005559 Open in IMG/M
Scaffold ID	Ga0066700_10000458 Open in IMG/M
Source Dataset Name	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	14702
Total Scaffold Genes	16 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	12 (75.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil → Grasslands Soil Microbial Communities From The Angelo Coastal Reserve, California, Usa

Source Dataset Sampling Location
Location Name	USA: California: Angelo Coastal Reserve
Coordinates	Lat. (^o)	39.7392	Long. (^o)	-123.6308	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F000871	Metagenome / Metatranscriptome	851	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0066700_100004582	F000871	AGAAGG	MRWLCFLLLASPSLTPAAIAQTSGTSPKSLQFDVAQVPATRDSFVFRLRGEERGWAVWQYEIRALEMTQQLVYTATSEFRPVEDERLRVVVNRVTGQPISTFHHIDLFSPRSDTVMVEHDLEVKRGEISGRRRVGTRSGGVKIVPVSRPFAPGTVLSDYVFLAGAVSNAAPGDSLAVSAYKEFDDSLVTLSFTAESPATIEVPAGRFDVLPLRSGGFRIYATRTGPRRVVKGETLDGAFAFELVRSGPVVPTPE*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.