NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0066699_10822648

Scaffold Ga0066699_10822648


Overview

Basic Information
Taxon OID3300005561 Open in IMG/M
Scaffold IDGa0066699_10822648 Open in IMG/M
Source Dataset NameGrasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)653
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil → Grasslands Soil Microbial Communities From The Angelo Coastal Reserve, California, Usa

Source Dataset Sampling Location
Location NameUSA: California: Angelo Coastal Reserve
CoordinatesLat. (o)39.7392Long. (o)-123.6308Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F019457Metagenome229Y

Sequences

Protein IDFamilyRBSSequence
Ga0066699_108226481F019457N/ALGDSQFSALKKDKLVKANLTVKLKEKLNLIILLLFNRYILSLNKDFIALY*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.