NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0058697_10006049

Scaffold Ga0058697_10006049


Overview

Basic Information
Taxon OID3300005562 Open in IMG/M
Scaffold IDGa0058697_10006049 Open in IMG/M
Source Dataset NameAgave microbial communities from Guanajuato, Mexico - As.Ma.e
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3876
Total Scaffold Genes10 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)9 (90.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → Rubrobacter → Rubrobacter radiotolerans(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave → Agave Microbial Communities From California, Usa, And Mexico

Source Dataset Sampling Location
Location NameGuanajuato, Mexico
CoordinatesLat. (o)21.7658Long. (o)-100.163Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003935Metagenome / Metatranscriptome461Y
F035208Metagenome / Metatranscriptome172Y

Sequences

Protein IDFamilyRBSSequence
Ga0058697_100060496F035208AGTAGMTYATFLSTVDVVALLASVVLLVILSALTLAPLDKFGGRSVVPFLISLVAIWAGAVFTIYLIKHTIV*
Ga0058697_100060499F003935AGGAGGMEVKMLPKFDYYIDNSDPDIVVVRRQDGSFVAAFSARGATREGIVEAAKEDYGKLIEAKAQSLGLREEGGRKRSA*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.