Scaffold Ga0058697_10038171

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0058697_10038171

Scaffold Ga0058697_10038171

Overview

Basic Information
Taxon OID	3300005562 Open in IMG/M
Scaffold ID	Ga0058697_10038171 Open in IMG/M
Source Dataset Name	Agave microbial communities from Guanajuato, Mexico - As.Ma.e
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1788
Total Scaffold Genes	4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	3 (75.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → Predicted Viral	(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave → Agave Microbial Communities From California, Usa, And Mexico

Source Dataset Sampling Location
Location Name	Guanajuato, Mexico
Coordinates	Lat. (^o)	21.7658	Long. (^o)	-100.163	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F036415	Metagenome / Metatranscriptome	170	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0058697_100381711	F036415	GGTGG	VVRKEDSVSEQRLLQKYRAGDQIDMVVRIQHAPMHLREVTARFFSTKGQEEGGIISHMDLSATPSISEDQPSQQLLGALHSEVRLSAKVAPDVAPGFYRLNRVTVKTYGGREHHYSAEELDEMGFEIVEEPDNRPVVLQIEMGFRTDY*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.