NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0058697_10098755

Scaffold Ga0058697_10098755


Overview

Basic Information
Taxon OID3300005562 Open in IMG/M
Scaffold IDGa0058697_10098755 Open in IMG/M
Source Dataset NameAgave microbial communities from Guanajuato, Mexico - As.Ma.e
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1208
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → unclassified Rubrobacteraceae → Rubrobacteraceae bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave → Agave Microbial Communities From California, Usa, And Mexico

Source Dataset Sampling Location
Location NameGuanajuato, Mexico
CoordinatesLat. (o)21.7658Long. (o)-100.163Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001264Metagenome / Metatranscriptome735Y
F003251Metagenome / Metatranscriptome497Y
F012099Metagenome / Metatranscriptome283Y

Sequences

Protein IDFamilyRBSSequence
Ga0058697_100987551F003251GAGGMVQAKTYTTEKEAKKAAARAYRPAILRLLNGRYACFQAGDALPQGARAVSRWGTDRWRAYN*
Ga0058697_100987552F001264AGGAGMRAQQTVNEMAEELLWRQARALAQKTGEPLLEALAAVLETPAGHQLEDLRVDPHQHEEARYWQARLPFERVSERAVHPV*
Ga0058697_100987553F012099N/APAYVALECDCGEKATLSAASTTTTCARCGADLGAFVREIGEREGRLPDELTHPWFYDAKERARQHERDEAAHPKGTPWRYNDITAAGDGE*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.