NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0068857_101867967

Scaffold Ga0068857_101867967


Overview

Basic Information
Taxon OID3300005577 Open in IMG/M
Scaffold IDGa0068857_101867967 Open in IMG/M
Source Dataset NameCorn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)588
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere → Corn, Switchgrass And Miscanthus Rhizosphere Microbial Communities From Kellogg Biological Station, Michigan, Usa

Source Dataset Sampling Location
Location NameUSA: Michigan, Kellogg Biological Station
CoordinatesLat. (o)42.3948Long. (o)-85.3738Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F004291Metagenome / Metatranscriptome445Y
F010654Metagenome / Metatranscriptome301Y
F036398Metagenome / Metatranscriptome170Y

Sequences

Protein IDFamilyRBSSequence
Ga0068857_1018679671F036398N/AQNGSGGDVLLAGVTTYVGLRPGMHAWIAMDWDVAHTTSAQFMPVRRHISFGVTQQFRLHL
Ga0068857_1018679672F004291AGGAGGMNSKRVALLVLLGSMVVVPVAQAQIKHIEMRVEGMT*
Ga0068857_1018679673F010654GAGVKKSLGRQSGVQTVEVSLIDGKVDVTPKEDGQIDPAQLLKATYDSGVSVAELDMIARGKVVKDSADNLVLQIQPNRSFVLSSNELS
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.