NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0049081_10120120

Scaffold Ga0049081_10120120


Overview

Basic Information
Taxon OID3300005581 Open in IMG/M
Scaffold IDGa0049081_10120120 Open in IMG/M
Source Dataset NameFreshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)972
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic → Freshwater Lentic Microbial Communities From The Great Laurentian Lakes, Mi, Usa For Biogeochemical Studies

Source Dataset Sampling Location
Location NameGreat Lakes, Michigan, USA
CoordinatesLat. (o)44.701094Long. (o)-82.854085Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F007741Metagenome / Metatranscriptome345N
F037193Metagenome / Metatranscriptome168Y
F102823Metagenome / Metatranscriptome101Y

Sequences

Protein IDFamilyRBSSequence
Ga0049081_101201201F007741GGAGGMKLWTNNTNAIHKVDDNMLYPRTTYVLPDELTGPTWDDSIPCPHKIKPYYKGRAAGGATAVYRAGAIGDAIIATAFVNYLVQESGGVVEVYAPARNLPLYAGLGAKLWPLPSSLEAWDSFDAHVPTDDLFSGQVGNTKLGTGPGNCYQRIYEWMGVWDEKTMAKYCKPVLHLIEPDHEELKAMGKWPLPSPFFA
Ga0049081_101201202F102823AGGMSALYDWIVVGAGLAIGKLLVAIAVITVVTAILAVFFIWEERSK*
Ga0049081_101201203F037193N/AMKSKDELAMQVKKEWDEQNLRWKLWLEAGGFTTEIFCYSSAEEEYSKCVRELVDHAYQMQSV*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.