NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0049080_10132257

Scaffold Ga0049080_10132257


Overview

Basic Information
Taxon OID3300005582 Open in IMG/M
Scaffold IDGa0049080_10132257 Open in IMG/M
Source Dataset NameFreshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)840
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic → Freshwater Lentic Microbial Communities From The Great Laurentian Lakes, Mi, Usa For Biogeochemical Studies

Source Dataset Sampling Location
Location NameGreat Lakes, Michigan, USA
CoordinatesLat. (o)44.504638Long. (o)-83.045851Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002009Metagenome / Metatranscriptome604Y
F010983Metagenome / Metatranscriptome296Y

Sequences

Protein IDFamilyRBSSequence
Ga0049080_101322571F010983N/AARRVVKDSKESTTKAAEHGTKMHTEMENILLGRAVSRDEILAPYIKTFSDWAEKNVEKTYWCEKGLVGAGYAGRCDAYVKLRGIGDAIIDLKNRKVNPKYDPFYDTDCAQLWAYRAASENPKCACVSVVLASNDATKLMTKVWDEDELYQAGIAFCAMQKVWAWVKGYTPPGMKL*
Ga0049080_101322572F002009AGGAGGMTAPTIQEMGNAAQEIVWRVMGKGSDKSAYGDWLEKDRPTHDYHIARAVRHLATAQMQLHKSSPCPDNNGETSVDHLERALV
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.