Scaffold Ga0049082_10158619

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0049082_10158619

Scaffold Ga0049082_10158619

Overview

Basic Information
Taxon OID	3300005584 Open in IMG/M
Scaffold ID	Ga0049082_10158619 Open in IMG/M
Source Dataset Name	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	783
Total Scaffold Genes	4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic → Freshwater Lentic Microbial Communities From The Great Laurentian Lakes, Mi, Usa For Biogeochemical Studies

Source Dataset Sampling Location
Location Name	Great Lakes, Michigan, USA
Coordinates	Lat. (^o)	44.701094	Long. (^o)	-82.854085	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F095464	Metagenome / Metatranscriptome	105	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0049082_101586193	F095464	AGGA	MTPREQSFCYLKQYIRAQRETPWIAKINAVEDRARCALQHLGGMTGDWYPYRPHECHYYYPQITTK*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.