NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0070722_10043264

Scaffold Ga0070722_10043264


Overview

Basic Information
Taxon OID3300005601 Open in IMG/M
Scaffold IDGa0070722_10043264 Open in IMG/M
Source Dataset NameMarine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1573
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment → Marine Sediment Microbial Communities From The Atlantic Coast Under Amendment With Organic Carbon And Nitrate

Source Dataset Sampling Location
Location NameAtlantic Coast
CoordinatesLat. (o)Long. (o)Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005129Metagenome / Metatranscriptome411Y
F051139Metagenome / Metatranscriptome144Y
F072257Metagenome / Metatranscriptome121Y

Sequences

Protein IDFamilyRBSSequence
Ga0070722_100432642F051139N/AMQTAKLKLPVKQFHQLHDLLGDILDHEAETNDFNMENSDIELMEDIRTELFNQIPDEEPIEITYAFTTAVDAHQVTPLKLYEIKRCSDGSGFLLKNDRRSEVYCIEKGCSHLSSDQSKNWNLITITND*
Ga0070722_100432643F072257N/AMQELDKVVHQWCDSNDRWMYIEYDRDGKVMGLNFMQGDDYEFFKKDWCVSDQGLTEFYKQMLYTFAYEQKNVPEHCFINSCMWAYHSANSARDEYAVYKKPTCRRQCTIYKTNTTVDR*
Ga0070722_100432645F005129N/AMTYKVKIAEVNKSFSLSHHSYIDLGVFTVNASTYSFLYPAVKTDWACDINETELEFLVNNKKCKYVGFKELYTQLYGNSFATFEADLIRQIEEEVAKRIVKEYPGTDVNF*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.