Scaffold Ga0074649_1111352

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0074649_1111352

Scaffold Ga0074649_1111352

Overview

Basic Information
Taxon OID	3300005613 Open in IMG/M
Scaffold ID	Ga0074649_1111352 Open in IMG/M
Source Dataset Name	Saline sediment microbial communities from Etoliko Lagoon, Greece - sediment
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Draft

Scaffold Components
Scaffold Length (bps)	965
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Sediment → Saline Water And Sediment → Saline Water And Sediment Microbial Community From Etoliko Lagoon, Greece

Source Dataset Sampling Location
Location Name	Greece: Etoliko Lagoon
Coordinates	Lat. (^o)	38.4825	Long. (^o)	21.315	Alt. (m)		Depth (m)	25
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F043354	Metagenome / Metatranscriptome	156	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0074649_11113521	F043354	GAGG	MGLGNWPHLL*FINMTNVYKMEKLKQEIRNYQLNAGKTYMQYESDGYSQYQNYLYKRALYGLNALTQEELASMCSKKKQRILNVYKRAQKVLNVFKQQVTNQYSNYIFKTLFPKSPWTDDMLAYSEVDEKFTNT

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.