NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0068856_101866768

Scaffold Ga0068856_101866768


Overview

Basic Information
Taxon OID3300005614 Open in IMG/M
Scaffold IDGa0068856_101866768 Open in IMG/M
Source Dataset NameCorn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)612
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere → Corn, Switchgrass And Miscanthus Rhizosphere Microbial Communities From Kellogg Biological Station, Michigan, Usa

Source Dataset Sampling Location
Location NameUSA: Michigan, Kellogg Biological Station
CoordinatesLat. (o)42.3948Long. (o)-85.3738Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F004291Metagenome / Metatranscriptome445Y
F010654Metagenome / Metatranscriptome301Y
F036398Metagenome / Metatranscriptome170Y

Sequences

Protein IDFamilyRBSSequence
Ga0068856_1018667681F010654GAGVKQHLGRQAGVQKVDVNLIDGKVDVTPKEDGQIDPAQLLKATYDSGVSTAEMDITARGRIIRNGSGGFALQVEPNQSFALAPNELSKTLEFLADTPAFVT
Ga0068856_1018667682F004291AGGAGMSVRNFALFVLLGSVMIGPAAEAQMKHIEMRVEGMT*
Ga0068856_1018667683F036398N/ASGGDALLLGITSYFGVRPGMHVWLGMDWDAAHSTGTTFMPVHQHISFGLTQQFRLPKKEKQ*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.