Scaffold Ga0077110_1041530

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0077110_1041530

Scaffold Ga0077110_1041530

Overview

Basic Information
Taxon OID	3300005639 Open in IMG/M
Scaffold ID	Ga0077110_1041530 Open in IMG/M
Source Dataset Name	Sediment ecosystem from Lake Washington, Seattle, Washington, USA - Combined assembly reannotation Gp0050987, Gp0050988, Gp0050989, Gp0050990, Gp0050991
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Finished

Scaffold Components
Scaffold Length (bps)	767
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Sediment → Sediment → Sediment Methylotrophic Communities From Lake Washington, Seattle, Washington, Usa

Source Dataset Sampling Location
Location Name	Lake Washington, Seattle, USA
Coordinates	Lat. (^o)	47.676484	Long. (^o)	-122.228394	Alt. (m)		Depth (m)	63
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F007038	Metagenome / Metatranscriptome	359	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0077110_10415302	F007038	AGG	MPRRIFLDTEWTAPPWSDRSELMWIGLADEQGRSWYGISSEAEIDPSTNDFVSGAFRLIAPDEPRMSRAQLAADVVDFCGDVDEFWAWVPTVERFAEWFGLGTEASELFDRCWNVDLQMLRALVNPWPTGWPSRLHNLNAAAAAA

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.