NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0075040_1789148

Scaffold Ga0075040_1789148


Overview

Basic Information
Taxon OID3300005646 Open in IMG/M
Scaffold IDGa0075040_1789148 Open in IMG/M
Source Dataset NamePermafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate RNA 2013_057 (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)592
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terriglobus → unclassified Terriglobus → Terriglobus sp. TAA 43(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil → Permafrost Soil Microbial Communities From The Arctic, To Analyse Light Accelerated Degradation Of Dissolved Organic Matter (Dom)

Source Dataset Sampling Location
Location NameAlaska, USA
CoordinatesLat. (o)68.6135Long. (o)-149.3144Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F096751Metagenome / Metatranscriptome104Y

Sequences

Protein IDFamilyRBSSequence
Ga0075040_17891481F096751AGGAGMGRTRFTKPTQIFAGLLTGLLFAMLAVPAGAQPATESRTGQGLGPVYDAAHETTLNGTIQQIVTKHVAGSPAGMHLMVAGPQGLVDAHVGPYLSKTTQAALRKGVPVQIVGSSVSMNGKQYFLARQLTFSGGRTVAIRNTHGLLTLVYGN

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.