NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0079203_1206055

Scaffold Ga0079203_1206055


Overview

Basic Information
Taxon OID3300005647 Open in IMG/M
Scaffold IDGa0079203_1206055 Open in IMG/M
Source Dataset NameMarine algae microbial communities from Bantry Bay - Bantry Bay, Ireland
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)529
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Genome And Metagenome Analysis Of Marine Red Algae Porphyra

Source Dataset Sampling Location
Location NameBantry Bay, Ireland
CoordinatesLat. (o)51.64Long. (o)-9.71Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F058639Metagenome134Y

Sequences

Protein IDFamilyRBSSequence
Ga0079203_12060551F058639N/AAAARPRRLHVVQLATCRHIALIVANRAATVYWAVTAVPRKTVDTTWLQNPKTRLARILAAARPRRSHVVQLAPCRHIAVSVANRAATVYWAVTAVPRKSVDTTCLENPRTRLARILAAARPRRLHVVQLAPCRHIALSVANRAATVYWAVTAVPRKSVDTTCLQNPRTRLARILAA

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.