Scaffold Ga0079202_10120172

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0079202_10120172

Scaffold Ga0079202_10120172

Overview

Basic Information
Taxon OID	3300005651 Open in IMG/M
Scaffold ID	Ga0079202_10120172 Open in IMG/M
Source Dataset Name	Marine algae microbial communities from Blueberry Hill - Blueberry Hill, Maine
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	894
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (33.33%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Eukaryota	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Genome And Metagenome Analysis Of Marine Red Algae Porphyra

Source Dataset Sampling Location
Location Name	USA: Blueberry Hill, Maine
Coordinates	Lat. (^o)	44.342	Long. (^o)	-68.065	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F013269	Metagenome	272	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0079202_101201723	F013269	N/A	DMVTADTFFLPVNVNDKRGGIRVRVNDHQGSNGLALQLVLPIAVCPVYVVADLDVRIAGCDPMVEVKFVTLLRLTQGLVDDRDLPAEAGHELAFAR*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.