NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0056135_10085419

Scaffold Ga0056135_10085419


Overview

Basic Information
Taxon OID3300005652 Open in IMG/M
Scaffold IDGa0056135_10085419 Open in IMG/M
Source Dataset NameMarine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Inanidrilus leukodermatus Group 1a BELIZE.1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1766
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (25.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Annelida → Digestive System → Digestive Tube → Extracellular Symbionts → Marine Gutless Worms Symbiont → Marine Gutless Worms Symbiont Microbial Communities From Various Locations

Source Dataset Sampling Location
Location NameMax Planck institute for Marine Microbiology, Germany
CoordinatesLat. (o)51.321602Long. (o)12.394572Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F007256Metagenome354Y
F013063Metagenome274Y

Sequences

Protein IDFamilyRBSSequence
Ga0056135_100854192F007256N/AVGQLVHTLPEGRPVHGVTLLAGEIYLLRAKERDQVEVYDVVTYCLQRCLTVPNACGFIDMTSCEHNRCVYIGDPIVECVHRLDVQGAVTRWTVNDVPQGLSVNAAHNVIVTCDVVRKVKVFSTHGDLLRELMVPSDVINPWHAIPTRSGQLIVCHGGFDDPVHGVCIPVT*
Ga0056135_100854193F013063N/AVHTGNVIVTCRVVRKVKVFSTHGDLLRELKLPSDVINPWHAIQTRSGQFIVCHGSSVLGDAVHRVCMMSDDGRHIVHSHGGQRGSDTGQYDVPCHLAVDDNEFVFVADRDNRRVTLLSPTLEYVRHVVSRDQLKWRPMSLCLDTERRVLYVIENEVKDGKYTGRVVVFSV*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.