Basic Information | |
---|---|
Taxon OID | 3300005654 Open in IMG/M |
Scaffold ID | Ga0079204_10054578 Open in IMG/M |
Source Dataset Name | Porphyra Blade Metagenome Co-Assembly |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 2111 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Rhodophyta → Bangiophyceae → Bangiales → Bangiaceae → Porphyra → Porphyra umbilicalis | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Genome And Metagenome Analysis Of Marine Red Algae Porphyra |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Blueberry Hill, Maine | |||||||
Coordinates | Lat. (o) | 44.342 | Long. (o) | -68.065 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F104364 | Metagenome | 100 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0079204_100545781 | F104364 | GAG | MFTQFPSPLRRETACRSHDYQVTLRLPLHTFRGPGATPHEQFLLSDRSRKTLLTTSLEVVEATIYDRVLEAGIWINLAHSFTQSKTTIPRMVVLRRQDSPEHDPQDDLTPTSGQFSARHAERSGLANRNDPS* |
⦗Top⦘ |