Scaffold Ga0073902_10022002

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0073902_10022002

Scaffold Ga0073902_10022002

Overview

Basic Information
Taxon OID	3300005656 Open in IMG/M
Scaffold ID	Ga0073902_10022002 Open in IMG/M
Source Dataset Name	Active sludge microbial communities from Klosterneuburg, Austria, studying microevolution and ecology of nitrifiers - Klosterneuburg WWTP active sludge metagenome KNB19-Kit
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	3168
Total Scaffold Genes	12 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (16.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge → Active Sludge And Wastewater Microbial Communities From Klosterneuburg, Austria

Source Dataset Sampling Location
Location Name	Austria: Klosterneuburg
Coordinates	Lat. (^o)	48.3	Long. (^o)	16.2	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F007965	Metagenome / Metatranscriptome	341	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0073902_1002200210	F007965	N/A	MKKKKETRGGKRPFSGRKKASYETKTIAFRVRVEFVEPIKKMVKDYVLERLSGGI*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.