NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0078894_10837347

Scaffold Ga0078894_10837347


Overview

Basic Information
Taxon OID3300005662 Open in IMG/M
Scaffold IDGa0078894_10837347 Open in IMG/M
Source Dataset NameFreshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)802
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Associated Families4

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Freshwater Lake Microbial Communities From The Great Lakes, Usa, Analyzing Microbial Food Webs And Carbon Cycling

Source Dataset Sampling Location
Location NameLake Michigan, USA
CoordinatesLat. (o)43.1998Long. (o)-86.5698Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000868Metagenome / Metatranscriptome853Y
F007468Metagenome / Metatranscriptome350Y
F025671Metagenome / Metatranscriptome200Y
F038241Metagenome / Metatranscriptome166Y

Sequences

Protein IDFamilyRBSSequence
Ga0078894_108373471F025671N/ALEYENRCYACQSFNTLDYCEDDCGEFCSECNQGSWQDEEAMAKCQTHMVLLETTEKVEA*
Ga0078894_108373472F000868GAGGMSDPHGIIGNYRKGGSMSFLENENQMVIDAEYSYIGEQLVEDWVNSNLDEGQLFADYRFAEMCESNYLKGRFNQFYDLKPEDQYYIEWDEEA*
Ga0078894_108373473F038241AGGAGGMLGYTKEDLDQMSNAVHDAKLFYIRNSDVEQVDQDPLVEGLLKANDFLQGLWAEGYFD*
Ga0078894_108373474F007468AGGMISYKDYGRRVILTKSSHFLEYMKLHLISLNQDLEADYNVQSKINIQGQIMATEHLLSVATDIMNNSNERVYG*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.