NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0078894_11143491

Scaffold Ga0078894_11143491


Overview

Basic Information
Taxon OID3300005662 Open in IMG/M
Scaffold IDGa0078894_11143491 Open in IMG/M
Source Dataset NameFreshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)662
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Associated Families4

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Freshwater Lake Microbial Communities From The Great Lakes, Usa, Analyzing Microbial Food Webs And Carbon Cycling

Source Dataset Sampling Location
Location NameLake Michigan, USA
CoordinatesLat. (o)43.1998Long. (o)-86.5698Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001460Metagenome / Metatranscriptome690Y
F049617Metagenome / Metatranscriptome146Y
F050154Metagenome / Metatranscriptome145Y
F059952Metagenome / Metatranscriptome133N

Sequences

Protein IDFamilyRBSSequence
Ga0078894_111434911F049617GGAMMMNAEDIGLPPHLQRMVNYDINGLDIMHGELKNLMLIWEKELEKAQAIEDESEEAMDSM
Ga0078894_111434912F050154GAGMKIHLISLNQDLDKDLNVESKINIQGQIMATEHLLSVATDIMNDNLQGKGY*
Ga0078894_111434913F001460GAGGMLGYTENDLNRMINAIHDAKLFYLRYPSDLMDKTELRNDLEMAVSFMQGLWAEGYFDYTN
Ga0078894_111434914F059952N/ALDEGQYYADKQFAEMSGDEFIYNEFNKFYNLKEGDEDYLC*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.