Scaffold Ga0074432_103611

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0074432_103611

Scaffold Ga0074432_103611

Overview

Basic Information
Taxon OID	3300005683 Open in IMG/M
Scaffold ID	Ga0074432_103611 Open in IMG/M
Source Dataset Name	Enhanced biological phosphorus removal bioreactor viral communities from the University of Queensland, Australia - SBR4-V91802 Phage Sequencing
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Queensland
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	19300
Total Scaffold Genes	19 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	8 (42.11%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Nutrient Removal → Biological Phosphorus Removal → Bioreactor → Lab-Scale Ebpr Bioreactor → Enhanced Biological Phosphorus Removal Bioreactor Microbial Communities From The University Of Queensland, Australia

Source Dataset Sampling Location
Location Name	St. Lucia, Queensland Australia
Coordinates	Lat. (^o)	-27.49999	Long. (^o)	153.012098	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F024268	Metagenome / Metatranscriptome	206	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0074432_1036117	F024268	AGGGGG	MPISELITGTEAVSTTEHSLATDTSYDTGDAQTTDGVYQFFLDVSDMIAGDQLQIRIYEKVRSGDTQRIVYQAILTGAQSEPIWVSPALTLMHGWDVTCDALAGTITVNWSLRQIA*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.