NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0066905_100073942

Scaffold Ga0066905_100073942


Overview

Basic Information
Taxon OID3300005713 Open in IMG/M
Scaffold IDGa0066905_100073942 Open in IMG/M
Source Dataset NameTropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2207
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (66.67%)
Novel Protein Genes5 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)4 (80.00%)
Associated Families5

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil → Tropical Forest Soil Microbial Communities From Panama Analyzed To Predict Greenhouse Gas Emissions

Source Dataset Sampling Location
Location NamePanama: Oeste
CoordinatesLat. (o)9.1086Long. (o)-79.8436Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000779Metagenome / Metatranscriptome895Y
F001070Metagenome / Metatranscriptome787Y
F004510Metagenome / Metatranscriptome435Y
F006474Metagenome / Metatranscriptome372Y
F040988Metagenome / Metatranscriptome160N

Sequences

Protein IDFamilyRBSSequence
Ga0066905_1000739421F006474GGAGGMLGAENDEPEMSFRRGYQQGAIEAFYAIERFLDPATREVLQAWIEKDVFMWRAKAMLGHPPNWRLNMLAGSRPARRPLDRLDLRYAAAAGL*
Ga0066905_1000739422F001070GGAMNSFDKMLGWFPHNATEWIEFIIVAVLLWLLMMVAISELELTSIS*
Ga0066905_1000739423F040988GGAGMPITPYLKGPYYFDLETRRALGIALEMACIALSTGDDDDHVRRTITDKLIALARTGERNPDVLCDKALEAICRPAHDFEKPSTDAAGRSPVSLASSAPAARPEPPG*
Ga0066905_1000739424F004510GAGGMITWALIASGVIALVLVVLVQGRWTSLDSWFAAVFASAIMAMVIDHFVNYIN*
Ga0066905_1000739425F000779N/AMTSDNSLSLTLRRLGEIESKLDRILEELRTPAAIGYSVRRGNLPRKD*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.