Basic Information | |
---|---|
Taxon OID | 3300005723 Open in IMG/M |
Scaffold ID | Ga0076816_10093861 Open in IMG/M |
Source Dataset Name | Mastotermes darwiniensis gut microbial communities from Townsville, Australia - TV02 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | University of Queensland |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 6467 |
Total Scaffold Genes | 16 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 12 (75.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Eukaryota → Opisthokonta | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Host-Associated → Insecta → Digestive System → Unclassified → Unclassified → Mastotermes Gut → Termite Gut Microbial Communities From Australia |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Townsville, Australia | |||||||
Coordinates | Lat. (o) | -19.280075 | Long. (o) | 146.824457 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F004326 | Metagenome | 443 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0076816_1009386115 | F004326 | GGA | MYGQFPHSLDEKMVDKEQSYRWLKFGGIKGETGTTIVVAQEQALLQEKKN* |
⦗Top⦘ |