Scaffold Ga0076816_10093861

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0076816_10093861

Scaffold Ga0076816_10093861

Overview

Basic Information
Taxon OID	3300005723 Open in IMG/M
Scaffold ID	Ga0076816_10093861 Open in IMG/M
Source Dataset Name	Mastotermes darwiniensis gut microbial communities from Townsville, Australia - TV02
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Queensland
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	6467
Total Scaffold Genes	16 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	12 (75.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Opisthokonta	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Insecta → Digestive System → Unclassified → Unclassified → Mastotermes Gut → Termite Gut Microbial Communities From Australia

Source Dataset Sampling Location
Location Name	Townsville, Australia
Coordinates	Lat. (^o)	-19.280075	Long. (^o)	146.824457	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F004326	Metagenome	443	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0076816_1009386115	F004326	GGA	MYGQFPHSLDEKMVDKEQSYRWLKFGGIKGETGTTIVVAQEQALLQEKKN*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.