NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0076816_10577331

Scaffold Ga0076816_10577331


Overview

Basic Information
Taxon OID3300005723 Open in IMG/M
Scaffold IDGa0076816_10577331 Open in IMG/M
Source Dataset NameMastotermes darwiniensis gut microbial communities from Townsville, Australia - TV02
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Queensland
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)623
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Insecta → Digestive System → Unclassified → Unclassified → Mastotermes Gut → Termite Gut Microbial Communities From Australia

Source Dataset Sampling Location
Location NameTownsville, Australia
CoordinatesLat. (o)-19.280075Long. (o)146.824457Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F077443Metagenome117Y

Sequences

Protein IDFamilyRBSSequence
Ga0076816_105773311F077443N/AMDLKEMSCEDGRWMELAQDRVKWQALVLAVLSLRV
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.