NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0076919_1011948

Scaffold Ga0076919_1011948


Overview

Basic Information
Taxon OID3300005731 Open in IMG/M
Scaffold IDGa0076919_1011948 Open in IMG/M
Source Dataset NameSeawater microbial communities from Vineyard Sound, MA, USA - succinate ammended T14
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Wisconsin, Madison
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)5066
Total Scaffold Genes8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (62.50%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → M → Microbial Degradation Of Oil

Source Dataset Sampling Location
Location NameUSA
CoordinatesLat. (o)41.4417Long. (o)-70.7744Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F011228Metagenome / Metatranscriptome293N
F036708Metagenome / Metatranscriptome169N

Sequences

Protein IDFamilyRBSSequence
Ga0076919_10119483F036708GAGMKTELKVMPSLQKKIDDLKALAEQQVERKLVDMAQTAVDLSPVDTGAYVTSFSFSTGAGRPRGKSSKGKPRTNPQAARSEGLSNLIKDLERIPSLLDTTSIVLRNNSPHAVAVEYGGRGWKTSPYFVFTKLRNIYG*
Ga0076919_10119486F011228AGGAMDLLDLTPTSDTVDVTIVHPTSFDVLNNDDDTPMVITVYAPHSKEYKAAMHEQTNKRLKQAQNKKKVEITAEDLEDATLDLLAKTTKGWKITYGGSKPKFSIAKAKEIYAEVFWIRDQIEEAVANSLDFTKA*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.