NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0076926_108476

Scaffold Ga0076926_108476


Overview

Basic Information
Taxon OID3300005738 Open in IMG/M
Scaffold IDGa0076926_108476 Open in IMG/M
Source Dataset NameSeawater microbial communities from Vineyard Sound, MA, USA - sterilised with crude oil T0
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Wisconsin, Madison
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2851
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (71.43%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Microbial Degradation Of Oil

Source Dataset Sampling Location
Location NameUSA
CoordinatesLat. (o)41.4417Long. (o)-70.7744Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002399Metagenome / Metatranscriptome563Y
F083372Metagenome113N

Sequences

Protein IDFamilyRBSSequence
Ga0076926_1084765F083372AGGAGMIMQQYKISYPRAEFAYARHIRDNLKHEGEIIYPHQPSCRLLEDGSWLLLTITGERLGTVSPNGTVRLT*
Ga0076926_1084767F002399N/AHKSIIGQLRKKYGLKDNTPIHKVEIAMSPKDWKDFSEALTFPNGKPTQRGK*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.