Scaffold Ga0076924_1047606

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0076924_1047606

Scaffold Ga0076924_1047606

Overview

Basic Information
Taxon OID	3300005747 Open in IMG/M
Scaffold ID	Ga0076924_1047606 Open in IMG/M
Source Dataset Name	Seawater microbial communities from Vineyard Sound, MA, USA - control T14
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Wisconsin, Madison
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1654
Total Scaffold Genes	4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	4 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Microbial Degradation Of Oil

Source Dataset Sampling Location
Location Name	USA
Coordinates	Lat. (^o)	41.4417	Long. (^o)	-70.7744	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F098931	Metagenome	103	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0076924_10476061	F098931	GGA	MGRVKDIFQDQRERASVVCPECDGDGKVVEVTYRVQSFDRDIGEPYEDPVDCERCQGEGAIFEEE

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.