NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0078117_1111617

Scaffold Ga0078117_1111617


Overview

Basic Information
Taxon OID3300005758 Open in IMG/M
Scaffold IDGa0078117_1111617 Open in IMG/M
Source Dataset NameCyanobacteria communities in tropical freswater systems - freshwater lake in Singapore
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterSingapore Centre on Environmental Life Sciences Engineering (SCELSE)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1650
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake Water → Cyanobacterial Bloom Metagenomics Project

Source Dataset Sampling Location
Location NameSingapore
CoordinatesLat. (o)1.411221Long. (o)103.905587Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F014737Metagenome / Metatranscriptome260Y
F045704Metagenome152Y

Sequences

Protein IDFamilyRBSSequence
Ga0078117_11116171F045704N/ATVGNLPSVASSTVVFAAGDFLQLGSYVYKVTQAVLRGSGSTVSVNLHRPVIGTPATGTLTAVGKDVYFPVYAEVCPTYTLTPMTSGAFVAWDQPFVFRENVAP*
Ga0078117_11116172F014737GGAGMTTTMAALNSANIRHAEFVKLSVGDPSSPTVYTFCNAAAPVTVGGITFSSLGALLAVGEVQRDVKATSFDMAISLTGIDPNYVALILSSNIKGSTVEVWRGFLDSDNQIITTPTTQFFKRWQGIINNVSISEDFNQQLRQRVATCTITCSSMRRVLENRIAGIKTNKTIWQSIYSGDTSMDRVDAISNTYFDFGGKPNVGGIASPGGAQDIPETQQN*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.