NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0066903_101756453

Scaffold Ga0066903_101756453


Overview

Basic Information
Taxon OID3300005764 Open in IMG/M
Scaffold IDGa0066903_101756453 Open in IMG/M
Source Dataset NameTropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1183
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil → Tropical Forest Soil Microbial Communities From Panama Analyzed To Predict Greenhouse Gas Emissions

Source Dataset Sampling Location
Location NamePanama: Oeste
CoordinatesLat. (o)9.1086Long. (o)-79.8436Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002423Metagenome / Metatranscriptome560Y
F005864Metagenome / Metatranscriptome388Y
F006486Metagenome / Metatranscriptome372Y

Sequences

Protein IDFamilyRBSSequence
Ga0066903_1017564531F002423N/AIWRQEGYMAPKPKPARFEFTVGMVLAMALTILVVMTWAVAAPSSSPIYHPQLLLLY*
Ga0066903_1017564532F005864GAGGMKPSASRIERMLEKIEARLVPPPRKCLSAIVHGDDEAEAKEKALAEHVARHPEDVGRTVEDFNWILHVIVPWPVR*
Ga0066903_1017564533F006486GAGGVSKDSDQTETAPRKFTLGPLGNLNQVTKGLAKTIRAMADGTLDSQVGARICNGLGIMRACLETQKLEQLEGRMDEIVHRVARDRTNAARERTSTDEAQRLSN*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.