Scaffold Ga0078393_138850

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0078393_138850

Scaffold Ga0078393_138850

Overview

Basic Information
Taxon OID	3300005777 Open in IMG/M
Scaffold ID	Ga0078393_138850 Open in IMG/M
Source Dataset Name	Human lung microbial communities from Normal Smoker Supraglottic 110406-1
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	New York University Langone Medical Center
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1193
Total Scaffold Genes	4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → Predicted Viral	(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Respiratory System → Lung → Unclassified → Lung Microbiome → Human Lung Microbial Communites From Healthy (Non-Smokers And Smokers) And Hiv Infected Subjects

Source Dataset Sampling Location
Location Name	New York City, New York, USA
Coordinates	Lat. (^o)	40.7127	Long. (^o)	-74.0059	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F054110	Metagenome	140	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0078393_1388502	F054110	N/A	MNGRRYVVDVRQSWSKYDKPCKVYIVNRMYTEEEYKLTFPHKYKKGKTFKQGQLYKKESEYSSTKQHEVLLFLVRTYKGGD*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.