NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0079639_1002579

Scaffold Ga0079639_1002579


Overview

Basic Information
Taxon OID3300005800 Open in IMG/M
Scaffold IDGa0079639_1002579 Open in IMG/M
Source Dataset NameSediment microbial communities of hot springs in Rotorua, New Zealand ? Tikitere hot spring, NZ13
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterOak Ridge National Laboratory
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)5940
Total Scaffold Genes10 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)9 (90.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Sediment → Unclassified → Thermal Hot Spring → Sediment Microbial Communities Of Hot Springs In Rotorua, New Zealand

Source Dataset Sampling Location
Location NameRotorua, NZ
CoordinatesLat. (o)-38.0631325Long. (o)176.360798Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F025877Metagenome200Y
F051554Metagenome144Y

Sequences

Protein IDFamilyRBSSequence
Ga0079639_10025791F051554AGGMGMQLRYYVPFKAQEGVNAEYAIKEKLINIEGVAIDTSVNANKWQVPSADLDYIVETLKGAQLRVDHAESALMVVGKVVDAWRDGDRVLFRAEVGDEKLIEKILRGYITHVSIQVDSDEVECSKCKRPSRKEGMLIHLCPGAWEVVHKPKVRELSIVASPAYKTTEFQPVGFFAAMNENQWDAILKHVVGSQLPDSHGNNVGSR
Ga0079639_10025793F025877GAGGMPGLDEGVTVWRYRVQDPDKFEKFRVKEITEGVKITLGKVKNSDRWEIQNYMFDKKRFKTREQVLNWLEKHLKSEVKTLLDFKAWNEARKRFLQVWLEISRISA*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.