NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0079639_1023462

Scaffold Ga0079639_1023462


Overview

Basic Information
Taxon OID3300005800 Open in IMG/M
Scaffold IDGa0079639_1023462 Open in IMG/M
Source Dataset NameSediment microbial communities of hot springs in Rotorua, New Zealand ? Tikitere hot spring, NZ13
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterOak Ridge National Laboratory
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1539
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Archaea → TACK group(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Sediment → Unclassified → Thermal Hot Spring → Sediment Microbial Communities Of Hot Springs In Rotorua, New Zealand

Source Dataset Sampling Location
Location NameRotorua, NZ
CoordinatesLat. (o)-38.0631325Long. (o)176.360798Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F079345Metagenome / Metatranscriptome116Y

Sequences

Protein IDFamilyRBSSequence
Ga0079639_10234622F079345GGAGGMLSEALGLNLEGLSTLQRKLLLELLHRRHPQYWSKITSPKCSWQSQKETLKEFLQNHQTELVKELAKAGLEFNDWKTVRRFRKNAENGAL*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.