NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0079957_1001407

Scaffold Ga0079957_1001407


Overview

Basic Information
Taxon OID3300005805 Open in IMG/M
Scaffold IDGa0079957_1001407 Open in IMG/M
Source Dataset NameMicrobial and algae communities from Cheney Reservoir in Wichita, Kansas, USA
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterOregon State University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)22286
Total Scaffold Genes38 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)6 (15.79%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake → Microbial And Algae Communities From Cheney Reservoir In Wichita, Kansas, Usa

Source Dataset Sampling Location
Location NameWichita, Kansas, USA
CoordinatesLat. (o)37.7330997Long. (o)-97.7990663Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F017300Metagenome / Metatranscriptome241Y
F030766Metagenome / Metatranscriptome184Y

Sequences

Protein IDFamilyRBSSequence
Ga0079957_100140734F030766N/AMAKKFYAQKDALGWPIPGTMMSGAKVPANLLEIPAQDVTPGAGEVAVAHPGDLRYFVRKDKKGNIIPNSLIISLKKPAGDVYEFKLVKAS*
Ga0079957_10014074F017300N/AMTTNVTVAADKNGNIIGVSENNPEYGWIRVEQHVRVINDRGWLRNAKRSALIKGKVQDLVDCNYQLGEEIPGKIIVVESLKPFNPENPDRDLKIAGDTGVICRIDDQPIYRQTFFTSNVNAEDDLIMHSNTEEIREVQAAQRSVAALTGLRRTETAEL*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.