NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0079957_1006018

Scaffold Ga0079957_1006018


Overview

Basic Information
Taxon OID3300005805 Open in IMG/M
Scaffold IDGa0079957_1006018 Open in IMG/M
Source Dataset NameMicrobial and algae communities from Cheney Reservoir in Wichita, Kansas, USA
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterOregon State University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)9767
Total Scaffold Genes12 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)10 (83.33%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake → Microbial And Algae Communities From Cheney Reservoir In Wichita, Kansas, Usa

Source Dataset Sampling Location
Location NameWichita, Kansas, USA
CoordinatesLat. (o)37.7330997Long. (o)-97.7990663Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000635Metagenome / Metatranscriptome970Y
F003112Metagenome / Metatranscriptome506N
F055684Metagenome / Metatranscriptome138N

Sequences

Protein IDFamilyRBSSequence
Ga0079957_10060183F003112GAGMTQKEYACFKEALRFAGENNTVARETKYIGKVKHLLSVNRSIKRIVEEGRDRDEIVDAVVHLAVALKYLEGKGRES*
Ga0079957_10060188F055684AGGAGMWITSTNNIIRQPQGIRIEDVNHPASIFWCWSKEQLAQIGVKPYHPASVPAGERVTGAYTEEVDGEVYERFNTEPIPQPEEPVNDPV*
Ga0079957_10060189F000635AGGAGMTLSEIAQYAGEKVGKTDSETLTFLQKAASLAYRRVWNFAPWRETVTSSTYSVGTNRTITLGTNVETPLSVSYDQAEVEPIDLATIISQDADLLEDTRTGTPVLYHFTGRNTSGIAQLDLYPRLETAGTISLRVVEKLKCLTRTNLIVDFPPTTQALDDELRLPHVHQVVLSLTHADALERERQYAKAQSVVQTANADLAAMANYELSQVGGIKQITPSSLGDLTTEEITAS*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.