NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0079971_106660

Scaffold Ga0079971_106660


Overview

Basic Information
Taxon OID3300005807 Open in IMG/M
Scaffold IDGa0079971_106660 Open in IMG/M
Source Dataset NameBasalt sediment microbial communities from Loihi, Hawaii, USA - Two Loihi Rocks
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing Center
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)641
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → Viruses → unclassified viruses → Circular genetic element sp.(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Benthic → Basalt Sediment → Basalt Sediment Microbial Communities From Loihi, Hawaii, Usa

Source Dataset Sampling Location
Location NameLo'ihi Seamount, Hawai'I
CoordinatesLat. (o)18.92Long. (o)-155.27Alt. (m)Depth (m)5000
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005319Metagenome405Y

Sequences

Protein IDFamilyRBSSequence
Ga0079971_1066601F005319N/AIMTDQQFLLIWIFSFFLYFAIYTIWIPLKTQKKIESWLKSAESDETLLMSLDVITKKIXEQMLIDFXEFMLPQARESFQKFWTGAMGHAAKELKNSDQGSNLSLMHSITKELENQPYYIQMLGAKLLPIITEAAKKQPIGKSVAEIGMGLQK*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.