Scaffold Ga0074471_10129666

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0074471_10129666

Scaffold Ga0074471_10129666

Overview

Basic Information
Taxon OID	3300005831 Open in IMG/M
Scaffold ID	Ga0074471_10129666 Open in IMG/M
Source Dataset Name	Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.43_YBM
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Oregon Health and Science University (OHSU)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	898
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) → Marine And Estuarine Microbial Communities From Columbia River Coastal Margin

Source Dataset Sampling Location
Location Name	Astoria, Oregon, USA
Coordinates	Lat. (^o)	46.17469	Long. (^o)	-123.84933	Alt. (m)		Depth (m)	.06
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F007038	Metagenome / Metatranscriptome	359	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0074471_101296662	F007038	GGAGG	MTRRIFLDTEWTKPPWSKQSELMWIGLADEEGRSWYGISSEVDIDPSTNDFISDVFRLITPDEPRLTNNEIAAAVIDFCGNVDEFWAWIPTLERFAEWFGLGEEAAGLYAKHWDVDLQMVRSLVQPWPDGWPDRLLDLNAAAVEAGVEIPPRAVNHLHPRVHTEWNRKLFELIRKSREK*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.