Scaffold Ga0074470_11733791

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0074470_11733791

Scaffold Ga0074470_11733791

Overview

Basic Information
Taxon OID	3300005836 Open in IMG/M
Scaffold ID	Ga0074470_11733791 Open in IMG/M
Source Dataset Name	Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Oregon Health and Science University (OHSU)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1005
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (33.33%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) → Marine And Estuarine Microbial Communities From Columbia River Coastal Margin

Source Dataset Sampling Location
Location Name	Astoria, Oregon, USA
Coordinates	Lat. (^o)	46.15968	Long. (^o)	-123.80651	Alt. (m)		Depth (m)	.06
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F034287	Metagenome / Metatranscriptome	175	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0074470_117337912	F034287	AGGAGG	MQLSPIEIVGICWGIVTALYLGLFLYRSIIGLHEEDTLYLSAGEAKLEAQQREVMKRINKLDGYSHRIGYAALALTLLLAGMWIYSAARELL*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.