Scaffold Ga0078893_12095067

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0078893_12095067

Scaffold Ga0078893_12095067

Overview

Basic Information
Taxon OID	3300005837 Open in IMG/M
Scaffold ID	Ga0078893_12095067 Open in IMG/M
Source Dataset Name	Exploring phylogenetic diversity in Port Hacking ocean in Sydney, Australia - Port Hacking PH4 TJ4-TJ18
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Australian Centre for Ecogenomics
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	632
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Marine Surface Water → Exploring Phylogenetic Diversity In Port Hacking Ocean In Sydney, Australia

Source Dataset Sampling Location
Location Name	Port Hacking, Australia
Coordinates	Lat. (^o)	-34.1192	Long. (^o)	151.2267	Alt. (m)		Depth (m)	1
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F058909	Metagenome / Metatranscriptome	134	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0078893_120950673	F058909	N/A	MQLTNIEENVLLVALDHMEEEILDLMSERTLHSPQWRERLN

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.