NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0068860_100484923

Scaffold Ga0068860_100484923


Overview

Basic Information
Taxon OID3300005843 Open in IMG/M
Scaffold IDGa0068860_100484923 Open in IMG/M
Source Dataset NameSwitchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1232
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere → Corn, Switchgrass And Miscanthus Rhizosphere Microbial Communities From Kellogg Biological Station, Michigan, Usa

Source Dataset Sampling Location
Location NameUSA: Michigan, Kellogg Biological Station
CoordinatesLat. (o)42.3948Long. (o)-85.3738Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000330Metagenome / Metatranscriptome1285Y
F000698Metagenome / Metatranscriptome930Y

Sequences

Protein IDFamilyRBSSequence
Ga0068860_1004849231F000330AGGMVMNAPNYETHQNISLGSNEVDRVRSLQKILTQLCGTNIFTSSTCFAPSFVWQPNGAECTQMVRNAPKRQFRVQWVGSGAFVAKNSDTTSWH
Ga0068860_1004849232F000698AGGMGWIGCCFRAFRTIWVRLGSFGWLTKLCAKRDELVQKFVPRSRVGIFRNECTRSTPLAPKLMFWCVSFHWVHSGPFGCLTKLGAKRAELVQKFVPRSRIRIFRNERTRSTPFDPKLTFWCISNLLGAFGTVWLPYETRQKTGRSSAKVRATKSRRNFSQQTHPIQPIGP*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.