 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Taxon OID | 3300005853 Open in IMG/M |
| Scaffold ID | Ga0079997_118698 Open in IMG/M |
| Source Dataset Name | Archaeal communities from Yellowstone National Park, Wyoming, USA - Perpetual Spouter C (PS_C) MetaG (SPADES assembly) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 32260 |
| Total Scaffold Genes | 32 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 19 (59.38%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Thermal Springs → Unclassified → Unclassified → Hot Spring → Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Yellowstone National Park, Wyoming, USA | |||||||
| Coordinates | Lat. (o) | 44.376 | Long. (o) | -110.69 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F068875 | Metagenome / Metatranscriptome | 124 | N |
| F081384 | Metagenome / Metatranscriptome | 114 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0079997_11869814 | F068875 | N/A | VVSLSDMAIQCRCGQPIEAFGVPSCYTKMAPIVRLIFTTKANQLITDPATQLELSPANSTFPDIYRLITPRLDEVTSERPEAITEEIGATTYYVRDAARTITATVGQIPTEWAQRVAELRCQAEVGVFLIDANGTIWGRKVDTQTGVAGAPLPVVPSSVDVRFAFPSYTSVQKHIISFQLPFVLADYEIIPLWNNREVLNYLAPQPVGFRVFEDGGTWVVFLFSKYHSPEGTIVVPIANVVVPSEIEIYDSTGTTLVATGASNLGGGKYSLTSSLTSGTQYILDCTAVSSPPRSQFDWPAIRVPFRA* |
| Ga0079997_11869818 | F081384 | N/A | MLITPSDFGGDYRLFNANNLDPDTIQAIDQAQAELARDLFPVGHSFITGNLPSAPPNLGLRALGLHNLFVPWVFLRLELGILGAGVKRASDVPGRSRFASGAFFAIARQYRYFLDDWLPYEGYIEGIASSPTVLNIPIIASQILAPGMEIEINSERYSVVASSTGLLTIDPPLPLGTGNVRFRQLSLRVNRKWNYL* |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |